Anti-ZNF423 Antibody (A88413)

Anti-ZNF423 Antibody

Rabbit polyclonal antibody to ZNF423.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 220-450 of human ZNF423 (NP_055884.2).

KPFKCTVCKRGFSSTSSLQSHMQAHKKNKEHLAKSEKEAKKDDFMCDYCEDTFSQTEELEKHVLTRHPQLSEKADLQCIHCPEVFVDENTLLAHIHQAHANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDSSNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKVVYSCPYCSKRDFNSLAVLEIHLKTIHADKPQQSHTCQICLDSM

Rabbit

Polyclonal

IgG

Unconjugated

160 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Early B cell factor associated zinc finger protein, Ebfaz, hOAZ, JBTS19, KIAA0760, NPHP14, Nur12, OAZ, OLF 1/EBF associated zinc finger, OLF1/EBF associated zinc finger protein, Olf1/EBF-associated zinc finger protein, Roaz, Smad and Olf interacting zinc finger protein, Smad- and Olf-interacting zinc finger protein, Zfp104, ZFP423, Zinc finger protein 423, zinc finger protein 423, mouse, homolog of, ZN423_HUMAN, ZNF423 zinc finger protein 423