Anti-ZDHHC9 Antibody (A16018)

Anti-ZDHHC9 Antibody

Rabbit polyclonal antibody to ZDHHC9.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 250-364 of human ZDHHC9 (NP_057116.2).

VALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPPEPPEPPQEAAEAEK

Rabbit

Polyclonal

IgG

Unconjugated

41 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Antigen MMSA 1, Asp His His Cys domain containing protein 9, CGI89, CXorf11, DHHC-9, DHHC9, MMSA1, MRXSZ, Palmitoyltransferase ZDHHC9, ZDHC9_HUMAN, ZDHHC 9, ZDHHC10, Zinc finger DHHC domain containing 10, Zinc finger DHHC domain containing protein 9, Zinc finger DHHC domain-containing protein 9, Zinc finger DHHC type containing 9, Zinc finger protein 379, Zinc finger protein 380, ZNF379, ZNF380