Anti-ZAK Antibody (A87767)

Anti-ZAK Antibody

Rabbit polyclonal antibody to ZAK.

WB, ICC/IF

WB: 1:500-1:2,000, ICC/IF: 1:50-1:200

Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 100-312 of human ZAK (NP_598407.1).

EEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERE

Rabbit

Polyclonal

IgG

Unconjugated

105 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AZK, Cervical cancer suppressor gene 4 protein, HCCS 4, HCCS-4, HCCS4, Human cervical cancer suppressor gene 4 protein, Leucine zipper and sterile alpha motif containing kinase, Leucine zipper- and sterile alpha motif-containing kinase, Mitogen activated protein kinase kinase kinase MLT, Mitogen-activated protein kinase kinase kinase MLT, Mixed lineage kinase 7, Mixed lineage kinase related kinase, Mixed lineage kinase related kinase MRK beta, Mixed lineage kinase with a leucine zipper and a sterile alpha motif, Mixed lineage kinase-related kinase, MLK 7, MLK like mitogen activated protein triple kinase, MLK related kinase, MLK-like mitogen-activated protein triple kinase, MLK-related kinase, MLK7, Mlklak, MLT, MLTK_HUMAN, MRK, Sterile alpha motif and leucine zipper containing kinase AZK, Sterile alpha motif- and leucine zipper-containing kinase AZK