Anti-XPD Antibody [ARC2401] (A305413)

Anti-XPD Antibody [ARC2401]

Rabbit monoclonal [ARC2401] antibody to XPD.

WB, IHC

WB: 1:500-1:1,000, IHC: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 600-700 of human XPD/ERCC2 (P18074).

ARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEH

Rabbit

Monoclonal

ARC2401

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Basic transcription factor 2 80 kDa subunit, BTF2 p80, COFS 2, COFS2, CXPD, DNA excision repair protein ERCC 2, DNA excision repair protein ERCC-2, DNA repair protein complementing XP D cells, DNA repair protein complementing XP-D cells, EM9, ERCC 2, ERCC2, ERCC2_HUMAN, Excision repair 2, Excision repair cross complementing rodent repair deficiency complementation, Excision repair cross complementing rodent repair deficiency, complementation group 2, MAG, MGC102762, MGC126218, MGC126219, OTTHUMP00000045860, OTTHUMP00000045861, OTTHUMP00000045862, OTTHUMP00000045863, TFIIH 80 kDa subunit, TFIIH basal transcription factor complex 80 kDa subunit, TFIIH Basal Transcription Factor Complex Helicase Subunit, TFIIH basal transcription factor complex helicase XPD subunit, TFIIH basal transcription factor complex p80 subunit, TFIIH p80, TTD, Xeroderma pigmentosum complementary group D, Xeroderma pigmentosum group D complementing protein, Xeroderma pigmentosum group D-complementing protein, XPDC