Anti-TIM50 Antibody (A12444)

Anti-TIM50 Antibody

Rabbit polyclonal antibody to TIM50.

WB: 1:1,000-1:4,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 190-456 of human TIMM50 (NP_001001563.1).

GNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP

Rabbit

Polyclonal

IgG

Unconjugated

39 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Homolog of yeast Tim50, Import inner membrane translocase subunit TIM 50, Import inner membrane translocase subunit TIM50, Import inner membrane translocase subunit TIM50 mitochondrial, MGC102733, Mitochondrial import inner membrane translocase subunit TIM50, TIM 50, TIM 50L, Tim50 like protein, TIM50L, TIM50_HUMAN, TIMM 50, TIMM50, Translocase of inner mitochondrial membrane 50 homolog, translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae), Translocase of inner mitochondrial membrane 50 homolog (yeast), Translocase of inner mitochondrial membrane 50, yeast, homolog of