Anti-Thromboxane synthase Antibody [ARC1189] (A307187)

Anti-Thromboxane synthase Antibody [ARC1189]

Rabbit monoclonal [ARC1189] antibody to Thromboxane synthase.

WB: 1:500-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thromboxane synthase (P24557).

MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVL

Rabbit

Monoclonal

ARC1189

IgG

Affinity purification.

60 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

BDPLT14, CYP5, CYP5A1, Cytochrome P450 5A1, Cytochrome P450, family 5, subfamily A, polypeptide 1, FLJ52771, GHOSAL, Platelet cytochrome P450 subfamily V, Tbxas1, THAS, THAS_HUMAN, Thromboxane A synthase 1, Thromboxane A synthase 1 (platelet), Thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A), Thromboxane A synthase 1 platelet cytochrome P450 subfamily V, Thromboxane-A synthase, TS, TXA synthase, TXAS, TXS