+1 (314) 370-6046 or
Contact Us
Explore our End of Year Promotion >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-TGF beta 1 Antibody (A92358)

Western Blot - Anti-TGF beta 1 Antibody (A92358) - Antibodies.com Immunohistochemistry - Anti-TGF beta 1 Antibody (A92358) - Antibodies.com Immunohistochemistry - Anti-TGF beta 1 Antibody (A92358) - Antibodies.com Immunofluorescence - Anti-TGF beta 1 Antibody (A92358) - Antibodies.com Immunofluorescence - Anti-TGF beta 1 Antibody (A92358) - Antibodies.com Immunofluorescence - Anti-TGF beta 1 Antibody (A92358) - Antibodies.com Immunofluorescence - Anti-TGF beta 1 Antibody (A92358) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to TGF beta 1 for WB, IHC and ICC/IF.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-TGF beta 1 Antibody
Description
Rabbit polyclonal antibody to TGF beta 1.
Applications
WB, IHC, ICC/IF
Dilutions
WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 291-390 of human TGF beta 1 (NP_000651.3).
Sequence
KNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
12 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
Camurati-Engelmann disease, Cartilage-inducing factor, CED, Differentiation inhibiting factor, DPD1, LAP, Latency-associated peptide, Prepro transforming growth factor beta 1, TGF beta, TGF beta 1 protein , TGF-beta 1 protein, TGF-beta-1, TGF-beta-5, TGF-beta1, TGFB, Tgfb-1, tgfb1, TGFB1_HUMAN, TGFbeta, TGFbeta1, Transforming Growth Factor b1, Transforming growth factor beta 1, Transforming growth factor beta 1a, transforming growth factor beta-1, transforming growth factor, beta 1, Transforming Growth Factor-ß1
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-TGF beta 1 Antibody (A92358) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-TGF beta 1 Antibody (A92358)
Western blot analysis of extracts of Mouse spleen, using Anti-TGF beta 1 Antibody (A92358) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry - Anti-TGF beta 1 Antibody (A92358) - Antibodies.comEnlarge Image
Figure 2: Immunohistochemistry - Anti-TGF beta 1 Antibody (A92358)
Immunohistochemistry analysis of paraffin-embedded human brain tissue using Anti-TGF beta 1 Antibody (A92358) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-TGF beta 1 Antibody (A92358) - Antibodies.comEnlarge Image
Figure 3: Immunohistochemistry - Anti-TGF beta 1 Antibody (A92358)
Immunohistochemistry analysis of paraffin-embedded human breast cancer tissue using Anti-TGF beta 1 Antibody (A92358) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence - Anti-TGF beta 1 Antibody (A92358) - Antibodies.comEnlarge Image
Figure 4: Immunofluorescence - Anti-TGF beta 1 Antibody (A92358)
Immunofluorescence analysis of A-549 cells using Anti-TGF beta 1 Antibody (A92358) at a dilution of 1:200 (40x lens). DAPI was used to stain the cell nuclei (blue).
Publishing research using Anti-TGF beta 1 Antibody (A92358)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-TGF beta 1 Antibody (A92358)

Antibodies.com Image Placeholder - Discover more for less
A281812
Anti-TGF beta 1 Antibody [TB21]
Mouse monoclonal [TB21] antibody to TGF beta 1 for Flow Cytometry, ELISA, IHC-Fr, WB and IHC-P.
Immunofluorescence - Anti-TGF beta 1 Antibody (A89925) - Antibodies.com
A89925
Anti-TGF beta 1 Antibody
Rabbit polyclonal antibody to TGF beta 1 for ICC/IF.
Western Blot - Anti-TGF beta 1 Antibody (A306738) - Antibodies.com
(4)
A306738
Anti-TGF beta 1 Antibody
Rabbit polyclonal antibody to TGF beta 1 for WB and ICC/IF.
SDS-PAGE - Anti-TGF beta 1 Antibody [M7824] - Low endotoxin, Azide free (A324254) - Antibodies.com
(3)
A324254
Anti-TGF beta 1 Antibody [M7824] - Low endotoxin, Azide free
Recombinant human monoclonal [M7824] antibody to TGF beta 1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Fresolimumab Biosimilar - Anti-TGF beta 1 Antibody - Low endotoxin, Azide free (A323462) - Antibodies.com
(3)
A323462
Fresolimumab Biosimilar - Anti-TGF beta 1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to TGF beta 1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-TGF beta 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324253) - Antibodies.com
(2)
A324253
Anti-TGF beta 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to TGF beta 1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-TGF beta 1 Antibody [NIS793] - Low endotoxin, Azide free (A324255) - Antibodies.com
(2)
A324255
Anti-TGF beta 1 Antibody [NIS793] - Low endotoxin, Azide free
Recombinant human monoclonal [NIS793] antibody to TGF beta 1 for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A283195
Anti-TGF beta 1 Antibody
Rabbit polyclonal antibody to TGF beta 1 for WB, IHC-P and ELISA.
SDS-PAGE - Anti-TGF beta 1 Antibody [SRK181] - Low endotoxin, Azide free (A324256) - Antibodies.com
(3)
A324256
Anti-TGF beta 1 Antibody [SRK181] - Low endotoxin, Azide free
Recombinant human monoclonal [SRK181] antibody to TGF beta 1 for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A322982
Anti-TGF beta 1 Antibody [OTI3B6]
Mouse monoclonal [OTI3B6] antibody to TGF beta 1 for Flow Cytometry, IF and WB.
Antibodies.com Image Placeholder - Discover more for less
A322981
Anti-TGF beta 1 Antibody [OTI3B6] - BSA and Azide free
Mouse monoclonal [OTI3B6] antibody to TGF beta 1 for Flow Cytometry, IF and WB.
Western Blot - Anti-TGF beta 1 Antibody (A13890) - Antibodies.com
A13890
Anti-TGF beta 1 Antibody
Rabbit polyclonal antibody to TGF beta 1 for WB.
Antibodies.com Image Placeholder - Discover more for less
A281812
Anti-TGF beta 1 Antibody [TB21]
Mouse monoclonal [TB21] antibody to TGF beta 1 for Flow Cytometry, ELISA, IHC-Fr, WB and IHC-P.
Immunofluorescence - Anti-TGF beta 1 Antibody (A89925) - Antibodies.com
A89925
Anti-TGF beta 1 Antibody
Rabbit polyclonal antibody to TGF beta 1 for ICC/IF.
Western Blot - Anti-TGF beta 1 Antibody (A306738) - Antibodies.com
(4)
A306738
Anti-TGF beta 1 Antibody
Rabbit polyclonal antibody to TGF beta 1 for WB and ICC/IF.
SDS-PAGE - Anti-TGF beta 1 Antibody [M7824] - Low endotoxin, Azide free (A324254) - Antibodies.com
(3)
A324254
Anti-TGF beta 1 Antibody [M7824] - Low endotoxin, Azide free
Recombinant human monoclonal [M7824] antibody to TGF beta 1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Fresolimumab Biosimilar - Anti-TGF beta 1 Antibody - Low endotoxin, Azide free (A323462) - Antibodies.com
(3)
A323462
Fresolimumab Biosimilar - Anti-TGF beta 1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to TGF beta 1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-TGF beta 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324253) - Antibodies.com
(2)
A324253
Anti-TGF beta 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to TGF beta 1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-TGF beta 1 Antibody [NIS793] - Low endotoxin, Azide free (A324255) - Antibodies.com
(2)
A324255
Anti-TGF beta 1 Antibody [NIS793] - Low endotoxin, Azide free
Recombinant human monoclonal [NIS793] antibody to TGF beta 1 for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A283195
Anti-TGF beta 1 Antibody
Rabbit polyclonal antibody to TGF beta 1 for WB, IHC-P and ELISA.
SDS-PAGE - Anti-TGF beta 1 Antibody [SRK181] - Low endotoxin, Azide free (A324256) - Antibodies.com
(3)
A324256
Anti-TGF beta 1 Antibody [SRK181] - Low endotoxin, Azide free
Recombinant human monoclonal [SRK181] antibody to TGF beta 1 for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A322982
Anti-TGF beta 1 Antibody [OTI3B6]
Mouse monoclonal [OTI3B6] antibody to TGF beta 1 for Flow Cytometry, IF and WB.
Antibodies.com Image Placeholder - Discover more for less
A322981
Anti-TGF beta 1 Antibody [OTI3B6] - BSA and Azide free
Mouse monoclonal [OTI3B6] antibody to TGF beta 1 for Flow Cytometry, IF and WB.
Western Blot - Anti-TGF beta 1 Antibody (A13890) - Antibodies.com
A13890
Anti-TGF beta 1 Antibody
Rabbit polyclonal antibody to TGF beta 1 for WB.
See all TGF beta 1 Antibodies
Main Menu Contact Us 0Checkout
Top