Anti-ST14 Antibody (A15083)

Anti-ST14 Antibody

Rabbit polyclonal antibody to ST14.

WB: 1:500-1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 566-855 of human ST14 (NP_068813.1).

TCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV

Rabbit

Polyclonal

IgG

Unconjugated

95 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Epithin, HAI, Matriptase, Membrane type serine protease, Membrane type serine protease 1, Membrane-type serine protease 1, MT SP1, MT-SP1, MTSP 1, MTSP1, Prostamin, PRSS 14, PRSS14, Serine protease 14, Serine protease TADG 15, Serine protease TADG-15, Serine protease TADG15, SNC 19, SNC19, ST 14, ST14/Matriptase, ST14_HUMAN, Suppression of tumorigenicity 14, Suppression of tumorigenicity 14 (colon carcinoma matriptase epithin), Suppression of tumorigenicity 14 (colon carcinoma), Suppressor of tumorigenicity 14 protein, Suppressor of tumorigenicity protein 14, TADG 15, TADG15, TMPRSS14, Tumor associated differentially expressed gene 15 protein, Tumor-associated differentially-expressed gene 15 protein