Anti-SLC6A14 Antibody (A8662)

Anti-SLC6A14 Antibody

Rabbit polyclonal antibody to SLC6A14.

WB: 1:500-1:1,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 131-234 of human SLC6A14 (NP_009162.1).

YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV

Rabbit

Polyclonal

IgG

Unconjugated

72 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Amino acid transporter ATB0+, Amino acid transporter B0+, ATB0+, BMIQ11, OBX, Sodium and chloride dependent neutral and basic amino acid transporter B(0+), Sodium and chloride dependent neutral and basic amino acid transporter B0+, Solute carrier family 6 (amino acid transporter), member 14, Solute carrier family 6 (neurotransmitter transporter), member 14, Solute carrier family 6 amino acid transporter member 14, Solute carrier family 6 member 14, Solute carrier family 6 neurotransmitter transporter member 14