Anti-SLC4A11 Antibody (A87601)

Anti-SLC4A11 Antibody

Rabbit polyclonal antibody to SLC4A11.

WB: 1:1,000-1:5,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SLC4A11 (NP_114423.1).

MSQVGGRGDRCTQEVQGLVHGAGDLSASLAENSPTMSQNGYFEDSSYYKCDTDDTFEAREEILGDEAFDTANSSIVSGESIRFFVNVNLEMQATNTENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLF

Rabbit

Polyclonal

IgG

Unconjugated

98 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Bicarbonate transporter related protein 1, Bicarbonate transporter-related protein 1, BTR1, CDPD, CHED2, Corneal endothelial dystrophy 2 autosomal recessive, dJ794I6.2, FECD4, MGC126418, MGC126419, NaBC1, S4A11_HUMAN, Sodium bicarbonate transporter-like protein 11, Sodium borate cotransporter 1, Sodium coupled borate cotransporter 1, Solute carrier family 4 member 11, Solute carrier family 4 sodium bicarbonate transporter like member 11, Solute carrier family 4 sodium borate transporter member 11