Anti-SLC17A6 Antibody (A90643)

Anti-SLC17A6 Antibody

Rabbit polyclonal antibody to SLC17A6.

WB: 1:500-1:2000

Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human SLC17A6 (NP_065079.1).

GEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS

Rabbit

Polyclonal

IgG

Unconjugated

60kDa

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Differentiation associated BNPI, Differentiation associated Na dependent inorganic phosphate cotransporter, Differentiation associated Na(+) dependent inorganic phosphate cotransporter, Differentiation-associated BNPI, Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter, DNPI, Sodium dependent inorganic phosphate cotransporter, Solute carrier family 17 (Sodium dependent inorganic phosphate cotransporter) member 6, Solute carrier family 17 member 6, Vesicular glutamate transporter 2, Vesicular glutamate transporter type 2, VGLU2_HUMAN, VGLUT 2, VGLUT2