Anti-SIRT4 Antibody (A91998)

Anti-SIRT4 Antibody

Rabbit polyclonal antibody to SIRT4.

ICC/IF: 1:50-1:200

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SIRT4 (NP_036372.1).

MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLA

Rabbit

Polyclonal

IgG

Unconjugated

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

MGC130046, MGC130047, MGC57437, NAD dependent deacetylase sirtuin 4, NAD dependent protein deacetylase sirtuin 4, NAD-dependent ADP-ribosyltransferase sirtuin-4, NAD-dependent protein deacetylase sirtuin-4, NAD-dependent protein lipoamidase sirtuin-4, mitochondrial, Regulatory protein SIR2 homolog 4, Silent mating type information regulation 2 homolog, Sir 2 like 4, SIR 2 like protein 4, Sir2 like 4, SIR2 like protein 4, SIR2-like protein 4, SIR2L 4, SIR2L4, SIR4_HUMAN, SIRT 4, Sirtuin (silent mating type information regulation 2 homolog) 4, Sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae), Sirtuin 4, Sirtuin type 4, Sirtuin-4, Sirtuin4