Anti-SHARP1 Antibody (A12995)

Anti-SHARP1 Antibody

Rabbit polyclonal antibody to SHARP1.

WB: 1:1,000-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human BHLHE41 (NP_110389.1).

LKSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLLTQQVPLSKGTGAPSAAGSAAAPCLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRM

Rabbit

Polyclonal

IgG

Unconjugated

75 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Basic helix-loop-helix domain containing class B3, BHE41_HUMAN, bHLH protein DEC2, bHLHB3, bHLHe41, Class B basic helix loop helix protein 3, Class B basic helix-loop-helix protein 3, Class E basic helix-loop-helix protein 41, DEC2, Differentially expressed in chondrocytes protein 2, Enhancer of split and hairy related protein 1, Enhancer-of-split and hairy-related protein 1, hDEC2, Moderately similar to basic-helix loop helix protein M.musculus, SHARP-1