Anti-RXFP4 Antibody (A89749)

Anti-RXFP4 Antibody

Rabbit polyclonal antibody to RXFP4.

WB: 1:500-1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 305-374 of human RXFP4 (NP_871001.1).

NPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG

Rabbit

Polyclonal

IgG

Affinity purification.

40 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

Chemerin chemokine-like receptor 2, Chemerin-like receptor 2, Chemokine-like receptor 2, CMKLR2, G-protein coupled receptor 1, G-protein coupled receptor 10, G-protein coupled receptor 100, G-protein coupled receptor GPCR142, GPCR142, GPR1, GPR10, GPR100, GR3, hGR3, Insulin-like peptide INSL5 receptor, PRLHR, Prolactin-releasing peptide receptor, PrRP receptor, PrRPR, Relaxin family peptide receptor 4, Relaxin-3 receptor 2, RLN3 receptor 2, RLN3R2