MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Predicted MW

20 kDa

Biologically Active

Yes

Biological Activity

<0.01 ng/ml, corresponding to a specific activity of 100,000,000 IU/mg.

Unit Definition

50 units is defined as the concentration of mouse LIF in 1 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies.

Purity

>95% as determined by RP-HPLC and SDS-PAGE.

Product Form

Lyophilized

Concentration

1 mg/ml

Formulation

Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 0.02% Tween 20.

Storage

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

Synonyms

CDF, Cholinergic Differentiation Factor, D factor, DIA, Differentiation inducing factor, differentiation inhibitory activity, Differentiation stimulating factor, Differentiation-stimulating factor, Emfilermin, Hepatocyte stimulating factor III, HILDA, Human interleukin in DA cells, Leukemia inhibitory factor, LIF_HUMAN, Melanoma derived LPL inhibitor, Melanoma-derived LPL inhibitor, MLPLI

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Publishing research using Recombinant Mouse LIF Protein (A61848)? Please let us know so that we can list the citation on this page.