Recombinant Human TIMP1 Protein (C-terminal His Tag) (A61936)

Recombinant Human TIMP1 Protein (C-terminal His Tag)

SDS-PAGE

HEK293 cells

Recombinant

Human

Protein fragment

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

C-terminal His Tag

Yes

>95% as determined by SDS-PAGE.

Lyophilized

Reconstitution dependent.

Lyophilized from Phosphate Buffered Saline.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

Clgi, Collagenase inhibitor, Collagenase inhibitor, Human, EPA, EPO, Erythroid Potentiating Activity, Erythroid-potentiating activity, Fibroblast collagenase inhibitor, FLJ90373, HCI, Human Collagenase Inhibitor, Metalloproteinase inhibitor 1, Metalloproteinase inhibitor 1 precursor, OTTHUMP00000023214 , TIMP, TIMP 1, TIMP metallopeptidase inhibitor 1 , TIMP-1, TIMP1 protein, TIMP1_HUMAN, Tissue Inhibitor of Metalloproteinase 1, Tissue inhibitor of metalloproteinases, Tissue inhibitor of metalloproteinases 1, Ttissue inhibitor of metalloproteinase 1 erythroid potentiating activity collagenase inhibitor