Recombinant Human TGF beta 2 Protein (N-terminal His Tag) (A63344)

Recombinant Human TGF beta 2 Protein (N-terminal His Tag)

SDS-PAGE

Nicotiana benthamiana

Recombinant

Human

Protein fragment

HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS

N-terminal His Tag

27.08 kDa

ED50: <40 ng/ml, as determined by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation, corresponding to a specific activity of 25,000 U/mg.

>97% as determined by SDS-PAGE.

Lyophilized

1 mg/ml

Lyophilized from 50 mM Tris HCl Buffer, pH 7.4.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

BSC-1 cell growth inhibitor, BSC1 cell growth inhibitor, Cetermin, G-TSF, Glioblastoma-derived T-cell suppressor factor, GTSF, LAP, Latency-associated peptide, MGC116892, MGF, Milk growth factor, Polyergin, TGF-beta-2, TGF-beta2, TGFB2, TGFB2_HUMAN, Transforming growth factor beta 2