Recombinant Human Oct4 Protein (C-terminal PolyR Tag) (A58886)

Recombinant Human Oct4 Protein (C-terminal PolyR Tag)

SDS-PAGE

Escherichia coli

Recombinant

Human

Full length protein

MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN

C-terminal PolyR Tag

>95% as determined by SEC-HPLC and SDS-PAGE.

Liquid

Lot Specific

Supplied in Phosphate Buffered Saline, pH 7.4, with 5% Glycerol.

Shipped at 4°C. Short term (2-4 weeks) store at 4°C. Long term store at -20°C. Avoid freeze/thaw cycles.

MGC22487, Oct 3, Oct 4, Oct-3, Oct-4, OCT3, Octamer binding protein 3, Octamer binding protein 4, Octamer binding transcription factor 3, Octamer binding transcription factor 4, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3, OTF 3, OTF 4, OTF-3, OTF3, OTF4, PO5F1_HUMAN, POU class 5 homeobox 1, POU domain class 5 transcription factor 1, POU domain transcription factor OCT4, POU domain, class 5, transcription factor 1, POU-type homeodomain-containing DNA-binding protein, POU5F1