Recombinant Human Myelin Oligodendrocyte Glycoprotein (C-terminal His Tag) (A60971)

Recombinant Human Myelin Oligodendrocyte Glycoprotein (C-terminal His Tag)

SDS-PAGE

Escherichia coli

Recombinant

Human

MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH

C-terminal His Tag

15.2 kDa

Lyophilized

Reconstitution dependent.

Lyophilized from 20 mM Acetic acid-Sodium Acetate Buffer, pH 4.5, with 150 mM Sodium chloride.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

BTN6, BTNL11, MGC26137, MOG, MOG alpha 5, MOG alpha 6, MOG AluA, MOG AluB, MOG Ig AluB, MOGIG2, MOG_HUMAN, Myelin-oligodendrocyte glycoprotein, NRCLP7