SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Predicted MW

58.5 kDa

Biologically Active

Yes

Biological Activity

The biological activity of recombinant human LIF was measured by the ability to induce differentiation of murine M1 myeloid leukemic cells. The minimal detectable concentration of human LIF in this assay is <0.05 ng/ml. The specific activity is >1 x 108 U/mg.

Purity

>98% as determined by RP-HPLC and SDS-PAGE.

Product Form

Lyophilized

Concentration

Reconstitution dependent.

Formulation

Lyophilized from Phosphate Buffered Saline.

Storage

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C. Avoid freeze/thaw cycles.

Synonyms

CDF, Cholinergic Differentiation Factor, D factor, DIA, Differentiation inducing factor, differentiation inhibitory activity, Differentiation stimulating factor, Differentiation-stimulating factor, Emfilermin, Hepatocyte stimulating factor III, HILDA, Human interleukin in DA cells, Leukemia inhibitory factor, LIF_HUMAN, Melanoma derived LPL inhibitor, Melanoma-derived LPL inhibitor, MLPLI

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Publishing research using Recombinant Human LIF Protein (A61463)? Please let us know so that we can list the citation on this page.