Recombinant Human BNP Protein (His Tag) (A325635)

Recombinant Human BNP Protein (His Tag)

SDS-PAGE

Escherichia coli

Recombinant

Human

Protein fragment

MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQ

His Tag

>90% as determined by SDS-PAGE.

Liquid

Lot Specific

Supplied in 20 mM TRIS-HCl, pH 7.5, with 500 mM Sodium Chloride, 4 mM Caclium Chloride, 4 mM Magneisum Chloride, and 60 mM beta-Mercaptoethanol.

Shipped at 4°C. Short term (1 week) store at 10°C. Long term store below -18°C. Avoid freeze/thaw cycles.

BNP(1-28), BNP(1-29), BNP(1-30), BNP(1-32), BNP(2-31), BNP(3-29), BNP(3-30), BNP(3-32), BNP(4-27), BNP(4-29), BNP(4-30), BNP(4-31), BNP(4-32), BNP(5-29), BNP(5-31), BNP(5-32), Brain natriuretic peptide 32, Brain type natriuretic peptide, Gamma brain natriuretic peptide, Natriuretic peptide B, Natriuretic peptide precursor B, natriuretic peptide, brain type, Natriuretic peptides B, natriuretic protein, NPPB