Recombinant Human BAFF-R Protein (A61634)

Recombinant Human BAFF-R Protein

SDS-PAGE

Escherichia coli

Recombinant

Human

Protein fragment

MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG

7.7 kDa

Yes

>95% as determined by RP-HPLC and SDS-PAGE.

Lyophilized

1 mg/ml

Lyophilized from 20 mM Phosphate Buffered Saline, pH 8, with 500 mM Sodium Chloride.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C. Avoid freeze/thaw cycles.

B cell activating factor receptor, B-cell-activating factor receptor, BAFF R, BAFF Receptor, BAFFR, BLyS receptor 3, BlySR3, BR 3, BR3, BROMIX, CD 268, CD268, CD268 antigen, CVID4, MGC138235, OTTHUMP00000028746, Prolixin, TNFRSF 13C, Tnfrsf13c, TR13C_HUMAN, Tumor necrosis factor receptor subunit member 13C, Tumor necrosis factor receptor superfamily member 13C