Anti-Ran Antibody [ARC0986] (A306349)

Anti-Ran Antibody [ARC0986]

Rabbit monoclonal [ARC0986] antibody to Ran.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 117-216 of human Ran (P62826).

IVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL

Rabbit

Monoclonal

ARC0986

IgG

Affinity purification.

24 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Androgen receptor associated protein 24, Androgen receptor-associated protein 24, ARA 24, ARA24, Gsp1, GTP binding nuclear protein RAN, GTP-binding nuclear protein Ran, GTPase Ran, Guanosine triphosphatase Ran, LPS, Member RAS oncogene family, OK/SW-cl.81, RAN member RAS oncogene family, RanGTPase, RAN_HUMAN, Ras like protein TC4, Ras related nuclear protein, Ras-like protein TC4, Ras-related nuclear protein, RASL2 8, TC 4, TC4