Anti-RAIDD Antibody (A13263)

Anti-RAIDD Antibody

Rabbit polyclonal antibody to RAIDD.

WB: 1:500-1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human RAIDD/RAIDD/CRADD (NP_003796.1).

MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE

Rabbit

Polyclonal

IgG

Unconjugated

22 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CASP2 and RIPK1 domain containing adaptor with death domain, Caspase and RIP adapter with death domain, Caspase and RIP adaptor with death domain, Cradd, CRADD_HUMAN, Death adaptor molecule RAIDD, Death domain containing protein CRADD, Death domain-containing protein CRADD, MGC9163, RIP associated ICH1/CED3 homologous protein with death domain, RIP associated protein with a death domain, RIP-associated protein with a death domain