Anti-RAD18 Antibody [ARC1058] (A307171)

Anti-RAD18 Antibody [ARC1058]

Rabbit monoclonal [ARC1058] antibody to RAD18.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad18 (Q9NS91).

MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESP

Rabbit

Monoclonal

ARC1058

IgG

Unconjugated

70 kDa / 90 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

2810024C04Rik, DNA repair protein rad18, E3 ubiquitin-protein ligase RAD18, EC 6.3.2.-, hHR 18, hHR18, hRAD 18, hRAD18, MGC156682, Postreplication repair E3 ubiquitin-protein ligase RAD18, Postreplication repair protein hRAD18p, Postreplication repair protein RAD18, RAD 18, RAD18 homolog, RAD18 homolog (S. cerevisiae), RAD18 S. cerevisiae homolog, RAD18 S. cerevisiae homolog of, RAD18 transcript variant, Rad18sc, RAD18_HUMAN, Radiation sensitivity protein 18, RING finger protein 73, RNF 73, RNF73, Structural maintenance of chromosomes protein 6, YCR066W, YCR66W