Anti-PTN Antibody (A88436)

Anti-PTN Antibody

Rabbit polyclonal antibody to PTN.

WB: 1:500-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human PTN (NP_002816.1).

KYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Rabbit

Polyclonal

IgG

Unconjugated

19 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

HARP, HB-GAM, HBBM, HBGAM, HBGF-8, HBGF8, HBNF, HBNF-1, HBNF1, heparin affin regulatory protein, Heparin binding growth associated molecule, Heparin binding growth factor 8, Heparin binding neurite outgrowth promoting factor 1, Heparin-binding brain mitogen, Heparin-binding growth factor 8, Heparin-binding growth-associated molecule, heparin-binding neurite outgrowth promoting factor, Heparin-binding neurite outgrowth-promoting factor 1, NEGF1, Neurite growth promoting factor 1, Neurite outgrowth-promoting factor, heparin-binding, OSF-1, OSF1, Osteoblast-specific factor 1, Pleiotrophin, pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1), PTN_HUMAN