Anti-PSME3 Antibody (A92892)

Anti-PSME3 Antibody

Rabbit polyclonal antibody to PSME3.

WB: 1:1,000-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human PSME3 (NP_005780.2).

KVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Rabbit

Polyclonal

IgG

Unconjugated

35 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

11S regulator complex gamma subunit, 11S regulator complex subunit gamma, Activator of multicatalytic protease subunit 3, Ki, Ki antigen, Ki nuclear autoantigen, Ki, PA28 gamma, PA28 gamma, PA28g, PA28gamma, Proteasome (prosome, macropain) activator subunit 3, Proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki), Proteasome activator 28 gamma, Proteasome activator 28 subunit gamma, Proteasome activator complex subunit 3, Proteasome activator subunit 3, PSME3_HUMAN, REG GAMMA, REG-gamma