Anti-PSAP Antibody (A306382)

Name: Anti-PSAP Antibody
Brand: Antibodies.com
SKU: A306382
Price: 470.0 USD
Availability: InStock

Enlarge Image

$470

Rabbit polyclonal antibody to PSAP for WB, IHC and ICC/IF.

100% Guarantee

Price Match Guarantee

Delivery

Freight Charges

$40 to United States

Lead Time

5-8 Business Days

Contact Us

Telephone

+1 (314) 370-6046

orders@antibodies.com

Guarantees

100% Quality Guarantee

Price Match Guarantee

Tags:

Knockout Validated Antibody

Specifications

Name

Anti-PSAP Antibody

Description

Rabbit polyclonal antibody to PSAP.

Applications

WB, IHC, ICC/IF

Dilutions

WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Reactivity

Human, Mouse, Rat

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 275-524 of human PSAP (NP_002769.1).

Sequence

KEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN

Host

Rabbit

Clonality

Polyclonal

Isotype

IgG

Conjugate

Unconjugated

Purification

Affinity purification.

Molecular Weight

63 kDa

Product Form

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Storage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonyms

A1 activator, Cerebroside sulfate activator, Co-beta-glucosidase, Component C, CSAct, Dispersin, GLBA, Glucosylceramidase activator, Proactivator polypeptide, Proactivator polypeptide precursor, Prosaposin, Prosaposin (sphingolipid activator protein 1), prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy), Protein A, Protein C, SAP-1, SAP-2, SAP1, Saposin A, Saposin B, Saposin B Val, Saposin C, Saposin D, Saposin-D, Saposins, SAP_HUMAN, Sgp1, Sphingolipid activator protein 1, Sphingolipid activator protein 2, Sulfated glycoprotein 1, Sulfatide/GM1 activator

Isotype Controls

Suitable Secondaries

See all Anti-Rabbit IgG Secondaries →

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Scientific Validation Data (11)

Enlarge Image

Figure 1: Western Blot - Anti-PSAP Antibody (A306382)

Western blot analysis of various lysates, using Anti-PSAP Antibody (A306382) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.

Enlarge Image

Figure 2: Western Blot - Anti-PSAP Antibody (A306382)

Enlarge Image

Figure 3: Western Blot - Anti-PSAP Antibody (A306382)

Western blot analysis of extracts from wild type(WT) and PSAP Rabbit polyclonal antibody knockout (KO) 293T cells, using Anti-PSAP Antibody (A306382) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.

Enlarge Image

Figure 4: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded human liver using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 5: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 6: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 7: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 8: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded rat brain using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 9: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded rat kidney using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 10: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 11: Immunofluorescence - Anti-PSAP Antibody (A306382)

Immunofluorescence analysis of U2OS cells using Anti-PSAP Antibody (A306382) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Show more images

Publishing research using Anti-PSAP Antibody (A306382)? Please let us know so that we can list the citation on this page.