Anti-PPP1R3B Antibody (A89267)

Anti-PPP1R3B Antibody

Rabbit polyclonal antibody to PPP1R3B.

WB: 1:500-1:2,000

Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human PPP1R3B (NP_078883.2).

MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVL

Rabbit

Polyclonal

IgG

Unconjugated

33 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

FLJ14005, FLJ34675, GL, Hepatic glycogen targeting protein phosphatase 1 regulatory subunit GL, Hepatic glycogen targeting subunit G(L), Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL, PP1 subunit R4, PPP1R4, PPR3B_HUMAN, Protein phosphatase 1 regulatory (inhibitor) subunit 3B, Protein phosphatase 1 regulatory subunit 3B, Protein phosphatase 1 regulatory subunit 4, Protein phosphatase 1 subunit 4, Protein phosphatase 1 subunit GL, PTG, R4