Anti-PIST Antibody (A15754)

Anti-PIST Antibody

Rabbit polyclonal antibody to PIST.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 195-454 of human PIST/PIST/GOPC (NP_001017408.1).

ARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY

Rabbit

Polyclonal

IgG

Unconjugated

51 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CAL, CFTR associated ligand, CFTR-associated ligand, dJ94G16.2, dJ94G16.2 PIST, FIG, Fused in glioblastoma, Golgi associated PDZ and coiled coil motif containing, Golgi associated PDZ and coiled coil motif containing protein, Golgi-associated PDZ and coiled-coil motif-containing protein, GOPC, GOPC 1, GOPC1, GOPC_HUMAN, OTTHUMP00000040403, PDZ protein interacting specifically with TC 10, PDZ protein interacting specifically with TC10, PDZ/coiled coil domain binding partner for the rho family GTPase TC 10, PDZ/coiled coil domain binding partner for the rho family GTPase TC10, Protein interacting specifically with Tc 10, Protein interacting specifically with Tc10