Anti-PIAS1 Antibody (A91054)

Anti-PIAS1 Antibody

Rabbit polyclonal antibody to PIAS1.

WB: 1:500-1:1,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human PIAS1 (NP_057250.1).

MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQK

Rabbit

Polyclonal

IgG

Unconjugated

76 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AR interacting protein, DDXBP1, DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1, DEAD/H box binding protein 1, DEAD/H box-binding protein 1, E3 SUMO-protein ligase PIAS1, GBP, Gu binding protein, Gu-binding protein, GU/RH-II, PIAS1_HUMAN, Protein inhibitor of activated STAT protein 1, Protein inhibitor of activated STAT, 1, RNA helicase II binding protein, RNA helicase II-binding protein, Zinc finger, MIZ-type containing 3, ZMIZ3