Anti-PHAP1 Antibody (A14963)

Anti-PHAP1 Antibody

Rabbit polyclonal antibody to PHAP1.

WB, IHC

WB: 1:500-1:2,000, IHC: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ANP32A (NP_006296.1).

MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE

Rabbit

Polyclonal

IgG

Unconjugated

28 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

acidic (leucine-rich) nuclear phosphoprotein 32 family, member A, Acidic leucine-rich nuclear phosphoprotein 32 family member A, Acidic nuclear phosphoprotein 32 family member A, Acidic nuclear phosphoprotein pp32, AN32A_HUMAN, ANP32A, C15orf1, Cerebellar leucine rich acidic nuclear protein, Hepatopoietin Cn, HPPCn, I1PP2A, Inhibitor 1 of protein phosphatase 2A, inhibitor-1 of protein phosphatase-2A, Lanp, Leucine rich acidic nuclear protein, Leucine-rich acidic nuclear protein, MAPM, Mapmodulin, MGC119787, MGC150373, PHAPI, Potent heat stable protein phosphatase 2A inhibitor I1PP2A, Potent heat-stable protein phosphatase 2A inhibitor I1PP2A, PP32, Putative HLA DR associated protein I, Putative HLA-DR-associated protein I, Putative human HLA class II associated protein I, Putative human HLA class II-associated protein