Anti-PGP9.5 Antibody (A89018)

Anti-PGP9.5 Antibody

Rabbit polyclonal antibody to PGP9.5.

WB: 1:500-1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 59-223 of human PGP9.5/PGP9.5/UCHL1 (NP_004172.2).

HENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA

Rabbit

Polyclonal

IgG

Unconjugated

25 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Epididymis luminal protein 117, Epididymis secretory protein Li 53, HEL 117, HEL S 53, NDGOA, Neuron cytoplasmic protein 9.5, OTTHUMP00000218137, OTTHUMP00000218139, OTTHUMP00000218140, OTTHUMP00000218141, Park 5, PARK5, PGP 9.5, PGP95, Protein gene product 9.5, Ubiquitin C terminal esterase L1, Ubiquitin C terminal hydrolase, Ubiquitin C terminal hydrolase L1, Ubiquitin carboxyl terminal esterase L1, Ubiquitin carboxyl terminal hydrolase isozyme L1, Ubiquitin carboxyl-terminal hydrolase isozyme L1, Ubiquitin thioesterase L1, Ubiquitin thiolesterase, Ubiquitin thiolesterase L1, UCH-L1, UCHL1, UCHL1_HUMAN