Anti-PATJ Antibody (A88478)

Anti-PATJ Antibody

Rabbit polyclonal antibody to PATJ.

WB: 1:500-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human INADL (NP_795352.2).

MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSN

Rabbit

Polyclonal

IgG

Unconjugated

170 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Channel interacting PDZ domain protein, Cipp, FLJ26982, hINADL, Inactivation no after potential D like protein, INAD like, InaD like Drosophila, INAD like protein, INADL, INADL protein, PALS 1 associated tight junction protein, PALS1 associated tight junction protein, PDZ domain protein, PDZ domain protein Drosophila inaD like, Post synaptic density 95 / discs large / zonula occludens 1 domain protein, Protein associated to tight junctions