Anti-P2Y12 Antibody (A90184)

Anti-P2Y12 Antibody

Rabbit polyclonal antibody to P2Y12.

WB: 1:100-1:500

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human P2RY12 (NP_795345.1).

INFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

Rabbit

Polyclonal

IgG

Unconjugated

45 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ADP glucose receptor, ADP-glucose receptor, ADPG R, ADPG-R, ADPGR, BDPLT8, G protein coupled receptor SP1999, Gi coupled ADP receptor HORK 3, Gi coupled ADP receptor HORK3, HORK 3, HORK3, P2RY 12, P2RY12, P2T(AC), P2Y 12, P2Y purinoceptor 12, P2Y(12)R, P2Y(AC), P2Y(ADP), P2Y(cyc), P2Y12 platelet ADP receptor, P2Y12_HUMAN, Platelet ADP receptor, Purinergic receptor P2RY12, Purinergic receptor P2Y G protein coupled 12, Purinergic receptor P2Y12, Putative G protein coupled receptor, SP 1999, SP1999