Anti-P15RS Antibody (A89496)

Anti-P15RS Antibody

Rabbit polyclonal antibody to P15RS.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 47-276 of human RPRD1A (NP_001290341.1).

PVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGERLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELRSRIQSLPDLSRLPNVTGSHMHLPFAGDIYSED

Rabbit

Polyclonal

IgG

Unconjugated

36 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

C77387, CDKN2B-related protein, Cyclin dependent kinase 2B inhibitor related protein, Cyclin dependent kinase inhibitor 2B related protein, Cyclin dependent kinase inhibitor 2B related protein (p15INK4B related protein), Cyclin dependent kinase inhibitor related protein, Cyclin-dependent kinase inhibitor 2B-related protein, FLJ10656, HsT3101, Hypothetical protein FLJ10656, KIAA4077, MGC19513, MGC29396, MGC36325, mKIAA4077, p15INK4B related protein, p15INK4B-related protein, Putative uncharacterized protein P15RS, Regulation of nuclear pre mRNA domain containing 1A, Regulation of nuclear pre-mRNA domain-containing protein 1A, RGD1307374, RPR1A_HUMAN, RPRD1A