Anti-Olig1 Antibody [ARC1850] (A308528)

Anti-Olig1 Antibody [ARC1850]

Rabbit monoclonal [ARC1850] antibody to Olig1.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 172-271 of human Olig1 (Q8TAK6).

RRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK

Rabbit

Monoclonal

ARC1850

IgG

Affinity purification.

35 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Basic domain helix loop helix protein class B 6, Basic domain helix loop helix protein class B6, BHLH B6, BHLHB 6, bHLHb6, bHLHe21, Class B basic helix-loop-helix protein 6, Class E basic helix-loop-helix protein 21, Olig 1, OLIG1_HUMAN, Oligo 1, Oligo1, Oligodendrocyte lineage transcription factor 1, Oligodendrocyte specific bHLH transcription factor 1, Oligodendrocyte transcription factor 1