Anti-NMDAR2B Antibody (A282854)

Anti-NMDAR2B Antibody

Rabbit polyclonal antibody to NMDAR2B.

This antibody recognises the ~180 kDa NMDA (N-methyl-D-aspartate) receptor NMDAR2B subunit.NMDA receptors are a class of ionotropic glutamate receptors. NMDA channels have been shown to be involved in long term potentiation, an activity dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), or NMDAR2D (GRIN2D).

WB, IHC-Fr, IP

IHC-Fr: 1:1,000 - 1:2,000, 3 µl of antibody will quantitatively immunoprecipitate all NMDAR2B in 200 µg of rat brain. Optimal working dilutions must be determined by the end user.

Rat, Mouse, Human, Fish

C-terminus fusion protein of Rat NMDAR2B (30kDa) corresponding to amino acids 984-1104.

HYHHHHRPHSIGSTSSIDGLYDCDNPPFTTQPRSISKKPLDIGLPSSKHSQLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNAAKRRKQQYKDSLKKRPASAKSRREFDE

Rabbit

Polyclonal

IgG

Unconjugated

Reconstitution dependent.

Lyophilized

Reconstitute with 50µl of Phosphate buffered saline

Lyophilized: Store at 4°C. Reconstituted: Store undiluted at -20°C, avoid freeze / thaw cycles. Storage in frost free freezers is not recommended. Should this product contain a precipitate we recommend microcentrifugation before use.

Rabbit anti Rat NMDA Receptor NR2B antibody recognizes the ~180 kDa NMDA (N-methyl-D-aspartate) receptor NMDAR2B subunit.NMDA receptors are a class of ionotropic glutamate receptors. NMDA channels have been shown to be involved in long term potentiation, an activity dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), or NMDAR2D (GRIN2D).

AW490526, EIEE27, Glutamate Receptor Ionotropic N Methyl D Aspartate 2B, Glutamate Receptor Ionotropic N Methyl D Aspartate subunit 2B, Glutamate receptor ionotropic NMDA2B, Glutamate receptor subunit epsilon 2, Glutamate receptor, ionotropic, NMDA2B (epsilon 2), Glutamate [NMDA] receptor subunit epsilon 2, Glutamate [NMDA] receptor subunit epsilon-2, GRIN 2B, GRIN2B, hNR 3, hNR3, MGC142178, MGC142180, MRD6, N methyl D asparate receptor channel subunit epsilon 2, N methyl D aspartate receptor subtype 2B, N methyl D aspartate receptor subunit 2B, N methyl D aspartate receptor subunit 3, N-methyl D-aspartate receptor subtype 2B, N-methyl-D-aspartate receptor subunit 3, NMDA NR2B, NMDA R2B, NMDE2, NMDE2_HUMAN, NME2, NR2B, NR3