Anti-NM23A Antibody (A12581)

Anti-NM23A Antibody

Rabbit polyclonal antibody to NM23A.

IHC: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human NME1/NM23A (NP_000260.1).

KPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Rabbit

Polyclonal

IgG

Unconjugated

21 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AWD, AWD, drosophila, homolog of, GAAD, Granzyme A activated DNase, Granzyme A-activated DNase, GZMA activated DNase, Metastasis inhibition factor NM23, NB, NBS, NDK A, NDKA, NDKA_HUMAN, NDP kinase A, NDPK-A, NDPKA, NM23, NM23 long variant, included, nm23-H1, NM23-M1, NM23H1B, included, NME/NM23 nucleoside diphosphate kinase 1, Nme1, NME1-NME2 spliced read-through transcript, included, Non-metastatic cells 1, protein (NM23A) expressed in, Nonmetastatic cells 1, protein expressed in, Nonmetastatic protein 23, Nonmetastatic protein 23, homolog 1, Nucleoside diphosphate kinase A, Tumor metastatic process-associated protein