Anti-NIR2 Antibody (A88183)

Anti-NIR2 Antibody

Rabbit polyclonal antibody to NIR2.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human PITPNM1 (NP_004901.2).

EIETYYLPDGGQQPNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWARTAAQTGPLMCAY

Rabbit

Polyclonal

IgG

Unconjugated

135 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

DRES9, Drosophila retinal degeneration B, Drosophila retinal degeneration B homolog, FLJ44997, membrane-associated 1, Membrane-associated phosphatidylinositol transfer protein 1, NIR 2, NIR-2, OTTHUMP00000236414, OTTHUMP00000236415, Phosphatidylinositol transfer protein, phosphatidylinositol transfer protein membrane associated, PITM1_HUMAN, PITPNM, PITPnm 1, Pitpnm1, PYK2 N terminal domain interacting receptor 2, Pyk2 N-terminal domain-interacting receptor 2, RD 9, RD9, RDGB, RDGB1, RDGBA1, retinal degeneration B alpha 1