Anti-NFAT5 Antibody (A88501)

Anti-NFAT5 Antibody

Rabbit polyclonal antibody to NFAT5.

WB: 1:500-1:2,000

Human

A synthetic peptide corresponding to a sequence within amino acids 1300 to the C-terminus of human NFAT5 (NP_619728.2).

LSPASMSALQTSINQQDMQQSPLYSPQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF

Rabbit

Polyclonal

IgG

Unconjugated

174 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Glutamine rich protein H65, KIAA0827, NF AT5, NF-AT5, NFAT 5, NFAT L1, NFAT like protein 1, NFAT5_HUMAN, NFATL 1, NFATL1, NFATZ, Nuclear factor of activated T cells, Nuclear factor of activated T cells 5, Nuclear factor of activated T cells 5 tonicity responsive, Nuclear factor of activated T-cells 5, OREBP, Osmotic response element binding protein, T cell transcription factor NFAT 5, T cell transcription factor NFAT5, T-cell transcription factor NFAT5, TonE binding protein, TonE-binding protein, TonEBP, Tonicity responsive enhancer binding protein, Tonicity-responsive enhancer-binding protein