Anti-NDUFS6 Antibody (A17040)

Anti-NDUFS6 Antibody

Rabbit polyclonal antibody to NDUFS6.

WB: 1:500-1:2,000

Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 29-124 of human NDUFS6 (NP_004544.1).

GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH

Rabbit

Polyclonal

IgG

Unconjugated

14 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

BC059730, CI 13kA, CI 13kD A, CI-13kD-A, CI13KDA, Complex I 13kD A, Complex I 13kDa subunit A, Complex I mitochondrial respiratory chain 13 kD subunit, Complex I-13kD-A, IP13, MGC107676, NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH coenzyme Q reductase), NADH dehydrogenase [ubiquinone] iron sulfur protein 6, mitochondrial, NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial, NADH ubiquinone oxidoreductase 13 kDa A subunit, NADH-ubiquinone oxidoreductase 13 kDa-A subunit, NADH:ubiquinone oxidoreductase NDUFS6 subunit, NADH:ubiquinone oxidoreductase subunit S6, NDUS6_HUMAN