Anti-NDUFS3 Antibody (A11705)

Anti-NDUFS3 Antibody

Rabbit polyclonal antibody to NDUFS3.

WB: 1:500-1:1,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 37-264 of human NDUFS3 (NP_004542.1).

ESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Rabbit

Polyclonal

IgG

Unconjugated

26 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CI 30, CI 30KD, CI-30kD, Complex I 30KD, Complex I 30kDa subunit, COMPLEX I, MITOCHONDRIAL RESPIRATORY CHAIN, 30-KD SUBUNIT, Complex I-30kD, mitochondrial, NADH coenzyme Q reductase, NADH dehydrogenase (ubiquinone) Fe S protein 3 30kDa, NADH dehydrogenase ubiquinone 30 kDa subunit, NADH dehydrogenase [ubiquinone] iron sulfur protein 3 mitochondrial, NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, NADH-ubiquinone oxidoreductase 30 kDa subunit, NADH-Ubiquinone Oxidoreductase Fe-S Protein 3, NDUS3_HUMAN