Anti-NDUFA1 Antibody (A16158)

Anti-NDUFA1 Antibody

Rabbit polyclonal antibody to NDUFA1.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NDUFA1 (NP_004532.1).

MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID

Rabbit

Polyclonal

IgG

Unconjugated

14 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CI MWFE, CI-MWFE, Complex I MWFE, complex I MWFE subunit, Complex I-MWFE, MWFE, MWFE, B. taurus, homolog of, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 1, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 1 7.5kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1, NADH oxidoreductase subunit MWFE, NADH ubiquinone oxidoreductase (complex 1), NADH ubiquinone oxidoreductase MWFE subunit, NADH-ubiquinone oxidoreductase 1 alpha subcomplex, 1, NADH-ubiquinone oxidoreductase MWFE subunit, NDUA1_HUMAN, NDUFA 1, Type I dehydrogenase, ZNF 183, ZNF183