Anti-NDRG1 Antibody [ARC0887] (A306340)

Anti-NDRG1 Antibody [ARC0887]

Rabbit monoclonal [ARC0887] antibody to NDRG1.

WB, IHC

WB: 1:500-1:2,000, IHC: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 295-394 of human NDRG1 (Q92597).

ISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC

Rabbit

Monoclonal

ARC0887

IgG

Unconjugated

48 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

42 kDa, Anti GC4, cap43, cmt4d, Differentiation related gene1 protein, Differentiation-related gene 1 protein, Drg 1, DRG-1, drg1, gc4, hmsnl, Human mRNA for RTP complete cds, N myc downstream regulated gene 1, N myc downstream regulated gene 1 protein, N-myc downstream-regulated gene 1 protein, Ndr 1, ndr1, NDRG 1, NDRG1 protein, NDRG1_HUMAN, Nickel specific induction protein, Nickel specific induction protein Cap43, Nickel-specific induction protein Cap43, nmsl, Nmyc downstream regulated, Nmyc downstream regulated gene1, Nmyc downstream regulated gene1 protein, Protein NDRG1, Protein regulated by oxygen 1, Protein regulated by oxygen1, Proxy1, Reduced in tumor, Reducin, Reducing agents and tunicamycin responsive protein, Reducing agents and tunicamycin-responsive protein, Rit42, RTP, targ1, TDD5, tdds, Tunicamycin responsive protein