Anti-NAB2 Antibody (A15001)

Anti-NAB2 Antibody

Rabbit polyclonal antibody to NAB2.

WB: 1:500-1:2000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NAB2 (NP_005958.1).

MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGE

Rabbit

Polyclonal

IgG

Affinity purification.

70kDa

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

EGR 1 binding protein 2, EGR-1-binding protein 2, EGR1 binding protein 2, MADER, Melanoma associated delayed early response protein, Melanoma-associated delayed early response protein, MGC75085, Nab 2, NAB2_HUMAN, NGFI A binding protein 2, NGFI A binding protein 2 (EGR1 binding protein 2), NGFI-A-binding protein 2, Protein MADER