Anti-MYL9 Antibody [ARC1284] (A307859)

Anti-MYL9 Antibody [ARC1284]

Rabbit monoclonal [ARC1284] antibody to MYL9.

WB: 1:500-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (P24844).

MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPE

Rabbit

Monoclonal

ARC1284

IgG

Unconjugated

20 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

20 kDa myosin light chain, Human 20kDa myosin light chain (MLC2) mRNA complete cds, LC20, MGC3505, MLC 2, MLC-2C, MLC2, MLY 9, MRLC1, MYL9_HUMAN, Myosin light chain 9 regulatory, Myosin light polypeptide 9 regulatory, myosin regulatory light chain 1, Myosin regulatory light chain 2, Myosin regulatory light chain 2 smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1, Myosin regulatory light polypeptide 9, Myosin RLC, Myosin vascular smooth muscle light chain 2, MYRL2, OTTHUMP00000030857, smooth muscle isoform