Anti-MUC1 Antibody [ARC0352] (A309097)

Anti-MUC1 Antibody [ARC0352]

Rabbit monoclonal [ARC0352] antibody to MUC1.

WB, IHC

WB: 1:500-1:2,000, IHC: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1156-1255 of human MUC1 (P15941).

VPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL

Rabbit

Monoclonal

ARC0352

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ADMCKD, ADMCKD1, Breast carcinoma associated antigen DF3, Breast carcinoma-associated antigen DF3, CA 15-3, CA15 3, CA15 3 antigen, CA15.3, Cancer antigen 15-3, Carcinoma associated mucin, Carcinoma-associated mucin, CD 227, CD227, DF3 antigen, EMA, Episialin, H23 antigen, H23AG, KL 6, KL-6, KL6, Krebs von den Lungen-6, MAM 6, MAM6, MCD, MCKD, MCKD1, Medullary cystic kidney disease 1 (autosomal dominant), Medullary cystic kidney disease, autosomal dominant, MUC 1, MUC-1, MUC-1/SEC, MUC-1/X, MUC1-alpha, MUC1-beta, MUC1-CT, MUC1-NT, MUC1/ZD, MUC1_HUMAN, Mucin 1, Mucin 1 transmembrane, Mucin 1, cell surface associated, Mucin-1 subunit beta, Peanut reactive urinary mucin, Peanut-reactive urinary mucin, PEM, PEMT, Polymorphic epithelial mucin, PUM, Tumor associated epithelial membrane antigen, Tumor associated epithelial mucin, Tumor associated mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin