Anti-MSK1 Antibody (A14917)

Anti-MSK1 Antibody

Rabbit polyclonal antibody to MSK1.

WB: 1:500-1:1,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 700-800 of human RPS6KA5 (NP_004746.2).

TPDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTLQPSNPADSNNPETLFQFSDS

Rabbit

Polyclonal

IgG

Unconjugated

90 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

90 kDa ribosomal protein S6 kinase 5, EC 2.7.11.1, KS6A5_HUMAN, MGC1911, Mitogen and stress activated protein kinase 1, MSPK1, Nuclear Mitogen And Stress Activated Protein Kinase 1, Nuclear mitogen- and stress-activated protein kinase 1, Ribosomal protein S6 kinase 90kD polypeptide 5, Ribosomal protein S6 kinase 90kDa, Ribosomal protein S6 kinase 90kDa polypeptide 5, Ribosomal Protein S6 Kinase Alpha 5, Ribosomal protein S6 kinase alpha-5, RLPK, RPS6KA5, RSK Like Protein Kinase, RSK-like protein kinase, RSKL, S6K alpha 5, S6K-alpha-5