Anti-MEK2 Antibody (A12576)

Anti-MEK2 Antibody

Rabbit polyclonal antibody to MEK2.

WB: 1:500-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK2 (NP_109587.1).

MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMAR

Rabbit

Polyclonal

IgG

Unconjugated

53 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Cardiofaciocutaneous syndrome, CFC syndrome, CFC4, Dual specificity mitogen activated protein kinase kinase 2, Dual specificity mitogen-activated protein kinase kinase 2, ERK activator kinase 2, FLJ26075, MAP kinase kinase 2, map2k2, MAPK / ERK kinase 2, MAPK/ERK kinase 2, MAPKK 2, MAPKK2, MEK 2, Microtubule associated protein kinase kinase 2, Mitogen activated protein kinase kinase 2, Mitogen activated protein kinase kinase 2 p45, MKK 2, MKK2, MP2K2_HUMAN, OTTHUMP00000165826, OTTHUMP00000165827, PRKMK 2, PRKMK2